Model Sprayidea *7/*8/*9 Specification 1 *4 **0g piece Color White Application Remove oil grease or sewing machine oil spots on the fiber textiles, fast and efficiency, no ring or staines left. Wi...
    Molecular formula C*2H*0 Molecular weight **4.*1 CAS Number ******4 Physicochemical property white crystal Melting point *8.***0 Boiling point **6 It is soluble in benzene, acetone, and ch......
    O-Terphenyl molecular formula C*8H*4 molecular weight **0.3 CAS Number ******1 Physicochemical property White crystal melting point ****9 boiling point **2 It is soluble in benzene, aceto......
    P-Terphenyl molecular formula C*8H*4 molecular weight **0.3 CAS Number ******4 Physicochemical property White crystal melting point ******3 boiling point **9 It is soluble in hot benzene, ......
    MTerphenyl molecular formula C*8H*4 molecular weight **0.3 CAS Number ****8 Physicochemical property White crystal melting point ***8 boiling point **5 It is soluble in benzene, acetone, ......
    with better effecs than other most frequently used light stabilizers, blended with AO providing heat stability, working well with UVA widely used in PP, HDPE, PU, ABS, PS etc
    Egyptian Rock melting Salt high sodium chloride, which reaches more than *9 and the moisture percentage than 0.5 , to 1 with the Capability of exporting up to on...
    Ingredients Services Europe Kamil Soltysiak company was founded in ***0 and since its inception excelling in the field of service spray-drying. We invite companies interested powdering liquid ...
    Product Features 1. ADP is a halogen-free flame retardant based on organic phosphinates. The product achieves its flame retardant effect through intumescence. The thermoplastic polymer with ...
    Appearance:white powder Chemical formula: C3H7N6O3P n CAS NO.:**********4 HS code *********0 Application Mainly used in polyamide and PBT, ...
    Myelin Oligodendrocyte Glycoprotein Peptide ****5 , Mouse, Rat Sequence: MEVGWYRSPFSRVVHLYRNGK *5 , 1mg: *0 USD, 5mg:**0 USD, *0mg: **0 USD and so on.
    RGD peptide c RGDyK , c RGDfK : 1mg: **0 USD, 5mg: **0 USD, *0mg: **0 USD c RGDfC , c RGDyC : 1mg: **0 USD, 5mg: **5 USD, *0mg: **0 USD
    LL**7 human Sequence: [LL-37, 37 aa] Purity: *5 Price: 1mg **0 USD, 5mg **0 USD, *0mg **0 USD and so on. If nee...
    GBL or Gamma-butyrolactone is used, among other things, as a solvent for polymers, including acrylic fibre, cellulose acetate and polystyrene, as thinner in nail polish remover, paint strippers and...
    We offer regular supplies of Soda Ash Dense or Light . Packaging: a. 1mt single layer jumbobags, or b. *0kg bags with inner liners put into 1mt jumbobags. Min order: **0mt We offer regular suppli...

無料会員

信頼ポイント : 0

    Prepared by improved Hummers method, low dispersability in water and easy to be separated. This product has a high stability and could be produced at Kilo quantity. We ar...
    We now have Prime Virgin Silver Metallic Mercury in great quantities and *0 of our product is for exportation. Our Prime Virgin Silver liquid Mercury meets the norms of international standards and...
    We now have Prime Virgin Silver Metallic Mercury in great quantities and *0 of our product is for exportation. Our Prime Virgin Silver liquid Mercury meets the norms of international standards and...
    Type: Red Mercury Chemical formula: Sb2O7Hg2 2Hg0 Sb2O3O2 Molecule: **0.6x2 2x**1.8 7x*6 **6.8g/mol Quality: Fluid Purity: *9.***6 Color: Cherry red Density: *0/*0 Melting point: **7.*0C...
    The material is a two-component, semi transparent adhesive addition liquid silicone rubber for injection or molding process. Organic plastic parts can be adhered on it, but metal mould will be demoul
    DADMAC Product introduction: Chemical name is dimethyl diallyl ammonium chloride.Other trade name is DMDAAC, DADMAC, cationic monomer.This product is of high purity, polymer grade, quaternary ammo...
    We offer *0 Cash discounts, long term credit payment, and guaranteed quality for all Biological Stains, pH Indicators, Laboratory Chemicals, Research Chemicals, R D Che...
    Property Unit Method Specification Appearance IMPCA *****8 Clear free of Suspended Matter Purity on Dry Basis wt. IMPCA *****2 ...
    Our company was founded in ***4. we have long history of production of high quality Hydrochloric Acid, Potassium Hydroxide, CL, Hydrogen, and other fine chemicals. In ***4, we utilized our own raw...
    WE HAVE 5 BRANCH OF PRODUCTION NAMELY AS BELOW - AGRICULTURAL PRODUCT STOCK -FORESTRY, TIMBER AND BUILDING MATERIALS - SCRAP MATERIALS - OFFICE MATERIALS AND HOUSE UTENSIL -INVESTMENT, TOURISM AN...
前へ  1  ...  3  4  5  6  7  8  9  10  11  次へ
Contact Us
BOOK A CALL
Book Call On Your Favorite Time

By Signing Up. I agree to TradeKey.com Terms of Use, Privacy Policy, IPR and receive emails related to our services